PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_26814
Common NameKK1_029270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 257aa    MW: 28661.2 Da    PI: 6.772
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_26814genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEde+l++++k++G+ +W++ ++  g+ R++k+c++rw++yl
    C.cajan_26814 14 RGAWSKEEDERLINYIKLHGTTNWRSLPQSAGLLRCGKSCRLRWLNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding47.44.3e-1567111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T eE   +++++ +lG++ W+ Ia+t++ gRt++++k++w++ 
    C.cajan_26814  67 RGNFTVEEANHIIHLHGLLGNK-WSQIAATLP-GRTDNEIKNYWNTC 111
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-22564IPR009057Homeodomain-like
PROSITE profilePS5129416.827961IPR017930Myb domain
SuperFamilySSF466892.95E-2813108IPR009057Homeodomain-like
SMARTSM007171.1E-131363IPR001005SANT/Myb domain
PfamPF002494.1E-171461IPR001005SANT/Myb domain
CDDcd001675.99E-121661No hitNo description
PROSITE profilePS5129423.81262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.3E-2565116IPR009057Homeodomain-like
SMARTSM007171.1E-1166114IPR001005SANT/Myb domain
PfamPF002491.4E-1267111IPR001005SANT/Myb domain
CDDcd001673.44E-869110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MGRTPCCDRE HTNRGAWSKE EDERLINYIK LHGTTNWRSL PQSAGLLRCG KSCRLRWLNY  60
LRPNIKRGNF TVEEANHIIH LHGLLGNKWS QIAATLPGRT DNEIKNYWNT CLKRHLISLG  120
IDPVTHNPLE KITTTPEANS QASGSGVTTT SDIHYFDVFL NSKVEISTDY AAGEEDSSSN  180
NVVTTSIEEV HPPLINLDLS LAPPSQPQEQ QEQVLSQRMC LRCGLGLQSN PSCSCQAMVS  240
VVTAPVSNNV EYQFFGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007159923.18e-96hypothetical protein PHAVU_002G279000g
SwissprotP813932e-77MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A151S2E10.0A0A151S2E1_CAJCA; Myb-related protein 308 family
STRINGGLYMA08G00810.22e-90(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.15e-71myb domain protein 4